PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004509m
Common NameEUTSA_v10004509mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SRS
Protein Properties Length: 346aa    MW: 36752.4 Da    PI: 7.9167
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004509mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.14e-711312773154
           DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 
                      sg+ +CqdCGnqakkdCah+RCRtCCksrg++C thvkstWvpaakrrerqqqla+ ++ +      + +kr+re+  +++++l +t+++s++ 
  Thhalv10004509m 131 SGGPNCQDCGNQAKKDCAHMRCRTCCKSRGLECPTHVKSTWVPAAKRRERQQQLASGQQPQ----GLSVPKRQREHIPARSTSLVCTRIPSHN- 219
                      6889***************************************************997776....56899*********************97. PP

           DUF702  97 kkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      +  l + ++P+evss+avfrcvrvssvddge+e+aY+tavsi+GhvfkGiLydqG++e
  Thhalv10004509m 220 PYGLGVGNFPPEVSSPAVFRCVRVSSVDDGEDEYAYKTAVSISGHVFKGILYDQGPAE 277
                      6699***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.4E-63134276IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.9E-27135177IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.7E-27228275IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAAFFSLGNG GGDGGGSSQD EHHHHHHSSN TSNYNPSPSG TESWLWCRNP NSNANANANA  60
NANAGGGDIA PSYKGTLELW QQHPSNQEML FQQQQRLDLY TSAAGLGVGP TNRTLFETSG  120
DALMMMRSGG SGGPNCQDCG NQAKKDCAHM RCRTCCKSRG LECPTHVKST WVPAAKRRER  180
QQQLASGQQP QGLSVPKRQR EHIPARSTSL VCTRIPSHNP YGLGVGNFPP EVSSPAVFRC  240
VRVSSVDDGE DEYAYKTAVS ISGHVFKGIL YDQGPAERSS SVGGSQPLNL ITAGPSASSS  300
SPNVSCNNGV VGSTSDHYID PASLNYPTPI NSFMTGTHFF SNPRA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2265100.0DQ226510.1 Thellungiella halophila clone ThBAC2 hypothetical protein genes, complete cds; transposon En/Spm, complete sequence; transposon Gypsy, complete sequence; and transposon AC-like element, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393825.10.0hypothetical protein EUTSA_v10004509mg
SwissprotQ9XGX00.0SHI_ARATH; Protein SHORT INTERNODES
TrEMBLQ0ZR590.0Q0ZR59_EUTHA; Putative uncharacterized protein
TrEMBLV4MIE90.0V4MIE9_EUTSA; Uncharacterized protein
STRINGAT5G66350.11e-179(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.11e-143Lateral root primordium (LRP) protein-related